SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009226 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009226
Domain Number 1 Region: 21-198
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.6e-38
Family Ypt/Rab-GAP domain of gyp1p 0.0027
Further Details:      
 
Domain Number 2 Region: 176-280
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000154
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009226   Gene: ENSPPYG00000008209   Transcript: ENSPPYT00000009599
Sequence length 304
Comment pep:novel chromosome:PPYG2:17:31207789:31213662:-1 gene:ENSPPYG00000008209 transcript:ENSPPYT00000009599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETELPPVTAWEVKQIWQEMRTSKWMEMLGEWETYENSKKLIDQVYKGIPMNIRGPVWSVL
LNIQEIKSKKPRKYKIMKEKGKRSSEHIHQINLDMSRTPRDHIFRDRYGAKQRELFYILL
AYWEYNPEVGYCRDLSHITTLFLLYLSEEDAFWALVQLLASKRHSLQGFHSPNGRTVQGL
QEHQEHVLPTSQPKTMWHLDKEGLRVQGSSLGCLLRMLNDGISLGLTLSLWDVYLLEGEQ
VLMSIASIAFKVQQKRLMKKSRSGLWARFWNQFFHTWAMDDTVLKHLRASMKKQTRKQGD
LSLP
Download sequence
Identical sequences H2NTF7
9600.ENSPPYP00000009226 ENSPPYP00000009226 ENSPPYP00000009226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]