SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009349 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009349
Domain Number 1 Region: 294-372
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 8.37e-24
Family Intermediate filament protein, coiled coil region 0.000032
Further Details:      
 
Domain Number 2 Region: 68-104
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000000033
Family Intermediate filament protein, coiled coil region 0.00066
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000009349
Domain Number - Region: 114-210
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0233
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009349   Gene: ENSPPYG00000008318   Transcript: ENSPPYT00000009726
Sequence length 431
Comment pep:known chromosome:PPYG2:17:44521736:44528405:1 gene:ENSPPYG00000008318 transcript:ENSPPYT00000009726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRRITSAARRSYISSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNA
GFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAEL
RELRLRLDQLTANSARLEVERDNLAQDLGTVRQKLQDETNLRLEAENNLAAYRQEADEAT
LARLDLERKTESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDMAKPDLTAALKEIRT
QYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR
GTNESLERQMREQEERHAREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALD
IEIATYRKLLEGEENRITIPVQTFSNLQIRGGKSTKDGENHKVTRHLKSLTIRVIPIQAH
QIVNGAPPACG
Download sequence
Identical sequences H2NTS4
ENSPPYP00000009349 ENSPPYP00000009349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]