SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009351 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009351
Domain Number 1 Region: 49-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000121
Family V set domains (antibody variable domain-like) 0.036
Further Details:      
 
Domain Number 2 Region: 274-364
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000638
Family I set domains 0.026
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000009351
Domain Number - Region: 172-204
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0275
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009351   Gene: ENSPPYG00000008319   Transcript: ENSPPYT00000009728
Sequence length 414
Comment pep:novel chromosome:PPYG2:17:44531741:44537351:-1 gene:ENSPPYG00000008319 transcript:ENSPPYT00000009728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLAPTTVLLWAWGSLQAFEIVEKENIFQKTPCPAFLMFENAAYLADMSFELPCHCKPEK
MTAVVWFYQKHLGSSHTKVLTDFDGRVLTEAAQVRVGSDMLTRFSIRMFSLLVFRAQPED
SGLYFCGTRKGDYFYAYDVDIQNSEGMVATFQDEGQEPFADEYYGHLHVFTTFWEWTPCD
RCGVRGEQWRIGLCYLQSPDLSPRYLKAVPDVVSCGSRAVPRKLRTKARDHTPEVLVRSC
LVPCEKTKTIREGVLAIVNYVSKVGSRPWVPQVPIQFHQQRLGHGLIISCPGARPEHAVA
WDKDRQHLYRTQYLKGVNRSMRVFIDHGNQLHIRFTQLDDRGIYYCWRQGVRVAGFRLGV
TSRGRYPASFSDPETRSAVELTLIGYLLITAVFVTIHLCRCCCYLFHCCPNFSP
Download sequence
Identical sequences H2NTS6
ENSPPYP00000009351 ENSPPYP00000009351 XP_009249930.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]