SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009365 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009365
Domain Number 1 Region: 33-483
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.4e-100
Family Integrin alpha N-terminal domain 0.0000000000000262
Further Details:      
 
Domain Number 2 Region: 775-1000
Classification Level Classification E-value
Superfamily Integrin domains 2.51e-64
Family Integrin domains 0.00025
Further Details:      
 
Domain Number 3 Region: 636-769
Classification Level Classification E-value
Superfamily Integrin domains 3.14e-36
Family Integrin domains 0.0000826
Further Details:      
 
Domain Number 4 Region: 483-635
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-35
Family Integrin domains 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009365   Gene: ENSPPYG00000008330   Transcript: ENSPPYT00000009742
Sequence length 1039
Comment pep:known_by_projection chromosome:PPYG2:17:45063327:45080688:1 gene:ENSPPYG00000008330 transcript:ENSPPYT00000009742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSHFGFSLDFHKDS
HGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLFFDLRDETRNVGSQTLQTFKA
RQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGN
TLSRIYMENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPIADIFSSYRP
GILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEI
LDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVY
LFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQV
LVFLGQSEGLSSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYR
AQPVVKASVQLLVQDSLNPAVRSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQ
LDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSL
NVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADN
VLELQMDAANEGEGAYEAELAVHLPQGTHYMRALSNVEGFERLICNQKKENETRVVLCEL
GNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVE
LRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQP
SDLLYILDIQPQGGLQCFPQPHVNPLKVDWGLPTPSPSPIHPAHHKRDRRQIFLPEPEQP
SRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAW
FNVSSLPYAVPPLSLPRGEAQVRTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWK
VGFFKRNRPPLEEDDEEGE
Download sequence
Identical sequences H2NTU0
9600.ENSPPYP00000009365 ENSPPYP00000009365 XP_002827479.1.23681 ENSPPYP00000009365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]