SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009369 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009369
Domain Number 1 Region: 2-157
Classification Level Classification E-value
Superfamily RUN domain-like 1.44e-33
Family RUN domain 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000009369
Domain Number - Region: 214-282
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0575
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009369   Gene: ENSPPYG00000008334   Transcript: ENSPPYT00000009746
Sequence length 410
Comment pep:known chromosome:PPYG2:17:45138886:45156449:-1 gene:ENSPPYG00000008334 transcript:ENSPPYT00000009746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSVKTLLEKYTAEPIDDSSEEFVNFAAILEQILSHRFKACAPAGPVSWFSSDGQRGFWDY
IRLACSKVPNNCVSSIENMENISTARAKGRAWIRVALMEKRMRIGLPSGWGPLPPHRRFY
DSGAIMLRDEATILTGMLIGLSAIDFSFCLKGEVLDGKTPVVIDYTPYLKFTQSYDYLTD
EEERHSAESSTSEDNSPEHPYLPLVTDEDSWYSKWHKMEQKFRIVYAQKGYLEELVRLRE
SQLKDLEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQLTGLIPSDHAPLAQGSKEL
TTPLVNQWPSLGTLNGAEGASNSKLYRRHSFMSTEPLSAEASLSSDSQRLGEGTRDEEPW
GPIGKDPTPSMLGLCGSLASIPSCKSLASFKSNECLVSDSPEGSPALSPS
Download sequence
Identical sequences H2NTU4
ENSPPYP00000009369 ENSPPYP00000009369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]