SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009462 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009462
Domain Number 1 Region: 308-386
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.44e-24
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 
Domain Number 2 Region: 78-112
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000022
Family Intermediate filament protein, coiled coil region 0.0022
Further Details:      
 
Domain Number 3 Region: 190-304
Classification Level Classification E-value
Superfamily Prefoldin 0.000000471
Family Prefoldin 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009462   Gene: ENSPPYG00000008416   Transcript: ENSPPYT00000009843
Sequence length 400
Comment pep:known chromosome:PPYG2:17:47876541:47881529:1 gene:ENSPPYG00000008416 transcript:ENSPPYT00000009843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSYSYRQSSAMSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSARFVSSSSSGG
YGGGYGGVLTASDGLLAGNEKLTMQNLNDRLASYLDKVRALEAANGELEVKIRDWYQKQG
PGPSRDYSHYYTTIQDLRDKILGATIENSRIVLQIDNARLAADDFRTKFETEQALRMSVE
ADINGLRRVLDELTLARTDLEMQIEGLKEELAYLKKNHEEEISTLRGQVGGQVSVEVDSA
PGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR
RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQN
QEYQRLMDIKSRLEQEIATYRSLLEGQEDHYSNLSASKVL
Download sequence
Identical sequences H2NU31
ENSPPYP00000009462 9600.ENSPPYP00000009462 ENSPPYP00000009462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]