SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009463 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009463
Domain Number 1 Region: 334-412
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.62e-25
Family Intermediate filament protein, coiled coil region 0.001
Further Details:      
 
Domain Number 2 Region: 103-137
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000209
Family Intermediate filament protein, coiled coil region 0.0019
Further Details:      
 
Domain Number 3 Region: 216-332
Classification Level Classification E-value
Superfamily Prefoldin 0.0000144
Family Prefoldin 0.022
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000009463
Domain Number - Region: 153-247
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00314
Family Myosin rod fragments 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009463   Gene: ENSPPYG00000008417   Transcript: ENSPPYT00000009844
Sequence length 456
Comment pep:known_by_projection chromosome:PPYG2:17:47886108:47890915:1 gene:ENSPPYG00000008417 transcript:ENSPPYT00000009844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTTFLQTSSSTFGGGSTRRGSLLAGGGGFGWGSLCGGGGSRSISASSARFVSSGSGGGY
GGGMRVCGFGGGAGSVFGGGFGGGVGGSFGGGFGGGDGGLLSGNEKITMQNLNDRLASYL
DKVRALEEANTDLEVKIRDWYQKQAPTSPERDYSQYFKTIEEHRDKIMATTIDNSRVILE
IDNARLAVDDFRLKYENELALRQGVEADINGLRRVLDELTLARTDLEMQIEGLNEELAYL
KKNHEEEMKEFDSQLAGQVNVEMDAAPGVDLTRVLAEMREQYEAMAERNRRDVEAWFFSK
TEELNKEVASNTEMIQTSKTEITDLRRTMQELEIELQSQLSMKAGLENSLAETECRYATQ
LQQIQGLIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMAGI
GIREASSGGGGSSSNFRINIEESLDGKVVSSRTREI
Download sequence
Identical sequences H2NU32
ENSPPYP00000009463 9600.ENSPPYP00000009463 XP_009250034.1.23681 ENSPPYP00000009463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]