SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009472 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009472
Domain Number 1 Region: 295-366
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.44e-22
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 
Domain Number 2 Region: 55-87
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000199
Family Intermediate filament protein, coiled coil region 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000009472
Domain Number - Region: 110-198
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0167
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number - Region: 168-283
Classification Level Classification E-value
Superfamily Prefoldin 0.0225
Family Prefoldin 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009472   Gene: ENSPPYG00000008426   Transcript: ENSPPYT00000009853
Sequence length 405
Comment pep:known_by_projection chromosome:PPYG2:17:48038516:48045390:1 gene:ENSPPYG00000008426 transcript:ENSPPYT00000009853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMPYNFCLPSLSCRTSCSSRPCVPPSCHGYTLPGACNIPANVSNCNWFCEGSFNGSEKET
MQFLNDRLASYLEKVRQLERDNAELENLIRERSQQQEPLLCPSYQSYFKTIEELQQKILC
SKSENARLVVQIDNAKLAADDFRTKYQTEQSLRQLVESDINSLRRILDELTLCRSDLEAQ
VESLKEELLSLKQNHEQEVNTLRCQLGDRLNVEVDAAPAVDLNQVLNETRSQYEALVETN
RREVEQWFATQTEELNKQVVSSSEQLQSYQAEIIELRRTVNALEIELQAQHNLRDSLENT
LTESEARYSAQLSQVQRLITNVESQLAEIRSDLERQNQEYQVLLDVRARLECEINTYRSL
LESEDCKLPSNPCATTNACEKPIGSCVTNPCGPRSRCGPCNTFGY
Download sequence
Identical sequences H2NU41
ENSPPYP00000009472 9600.ENSPPYP00000009472 ENSPPYP00000009472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]