SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009473 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009473
Domain Number 1 Region: 294-365
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 5.41e-22
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 
Domain Number 2 Region: 54-86
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000398
Family Intermediate filament protein, coiled coil region 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000009473
Domain Number - Region: 109-197
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0207
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number - Region: 167-282
Classification Level Classification E-value
Superfamily Prefoldin 0.0228
Family Prefoldin 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009473   Gene: ENSPPYG00000008427   Transcript: ENSPPYT00000009854
Sequence length 404
Comment pep:known_by_projection chromosome:PPYG2:17:48058490:48063136:1 gene:ENSPPYG00000008427 transcript:ENSPPYT00000009854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYSCGLPSLSCRTSCSSRPCVPPSCHGCTLPGACNIPANVSNCNWFCEGSFNGSEKETM
QFLNNRLASYLEKVRQLERDNAELENLIRERSQQQEPLVCASYQSYFKTIEELQQKILCS
KSENARLVVQIDNAKLASDDFRTKYETEVSLRQLVESDINGLRRILDELTLCRSDLEAQV
ESLKEELLCLKQNHEQEVNTLRCQLGDRLNVEVDAAPAVDLNQVLNETRSQYEALVETNR
REVEQWFATQTEELNKQVVSSSEQLQSYQAEIIELRRTVNALEIELQAQHNLRDSLEHTL
TESEARYSSQLSQVQRLITNVESQLAEIRSDLERQNQEYQVLLDVRARLECEINTYRSLL
ESEDCKLPSNPCATTNACEKSTGPCISNPCGLRAQCRPCNTFGY
Download sequence
Identical sequences H2NU42
9600.ENSPPYP00000009473 ENSPPYP00000009473 ENSPPYP00000009473 XP_009250043.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]