SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009495 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009495
Domain Number 1 Region: 367-445
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.36e-24
Family Intermediate filament protein, coiled coil region 0.00087
Further Details:      
 
Domain Number 2 Region: 134-169
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000188
Family Intermediate filament protein, coiled coil region 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000009495
Domain Number - Region: 188-280
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000732
Family Myosin rod fragments 0.0088
Further Details:      
 
Domain Number - Region: 249-365
Classification Level Classification E-value
Superfamily Prefoldin 0.0068
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009495   Gene: ENSPPYG00000008449   Transcript: ENSPPYT00000009876
Sequence length 564
Comment pep:known_by_projection chromosome:PPYG2:17:48580278:48584379:1 gene:ENSPPYG00000008449 transcript:ENSPPYT00000009876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRYSSSKHYSSSRSGGGGGGGGGGSSLRISSSKGSLGGGFSSGGFSGGSFSRGSSGGG
CFGGSSGGYGGSGGFGGGSFRGSYGSSSFGGGYGGSFGGGSFGGGSFGGGSFGGGGFGGG
FGGGFGGDGGLLSGNEKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSHQ
GEPRDYSKYYKTIDDLKNQILNLTTDNANILLQIDNARLAADDFRLKYENEVALRQSVEA
DINGLRRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRNVSTGDVNVEMNAAP
GVDLTQLLNNMRSQYEQLAEQNRKDAEAWFNEKSKELTTEIDSNIEQISSYKSEITELRR
NVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQIRAETECQNT
EYQQLLDIKIRLENEIQTYRSLLEGEGSSGGGGRGGGSFSGGYGGGSSGGGSSGGGYGGG
HGGSSGGSYGGGSSGGGSSGGGYGGGSSSGGHGGSSGGGYGGGSSGGGGGGSSGGGYGGG
SSSGGHKSSSSGSVGESSSKGPRY
Download sequence
Identical sequences H2NU64
ENSPPYP00000009495 ENSPPYP00000009495 9600.ENSPPYP00000009495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]