SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009496 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009496
Domain Number 1 Region: 318-396
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 9.24e-21
Family Intermediate filament protein, coiled coil region 0.00095
Further Details:      
 
Domain Number 2 Region: 84-118
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000131
Family Intermediate filament protein, coiled coil region 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000009496
Domain Number - Region: 130-231
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00392
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009496   Gene: ENSPPYG00000008450   Transcript: ENSPPYT00000009877
Sequence length 464
Comment pep:known_by_projection chromosome:PPYG2:17:48602923:48610384:1 gene:ENSPPYG00000008450 transcript:ENSPPYT00000009877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLRFSNGSRHVCLRSGAGSVRPPNGGAGFAGSSAYGGSVAGSEFSCALGGGLGSVPGGS
HAGGALGNAACIGFAGSEGGLLSGNEKVTLQNLNDRLATYLDNVRALEEANAELERKIKG
WYEKYGPGSCRGLDHDYSRCHLTIEDLKNKIISSTTTNANVILQIDNARLAADDFRLKYE
NELTLHQNVEADINGLRRVLDELTLCRTDQELQYESLSEEMTYLKKNHEEEMKALQCAAG
GNVNVEMNAAPGVDLAVLLNNMRAEYEALAEQNRKDAEAWFNEKSASLQQQISHDSGAAT
SARSQLTEMRRTLQTLEIQLQSLLATKHSLECSLTETESNYCAQLAQIQAQIGALEEQLH
QVRTETEGQKLEYEHLLDVKVHLEKEIETYCHLIDGDGNSCSKSKGFGSGSPGNSSKDLS
RTTLVKTVVEEIDQRGKVLSSRIHSIEEKTSKMTNGKTEQRVPF
Download sequence
Identical sequences H2NU65
ENSPPYP00000009496 ENSPPYP00000009496 9600.ENSPPYP00000009496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]