SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009497 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009497
Domain Number 1 Region: 316-394
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.17e-20
Family Intermediate filament protein, coiled coil region 0.00091
Further Details:      
 
Domain Number 2 Region: 82-116
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000785
Family Intermediate filament protein, coiled coil region 0.0024
Further Details:      
 
Domain Number 3 Region: 129-229
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000654
Family Myosin rod fragments 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000009497
Domain Number - Region: 198-323
Classification Level Classification E-value
Superfamily Prefoldin 0.0497
Family Prefoldin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009497   Gene: ENSPPYG00000008451   Transcript: ENSPPYT00000009878
Sequence length 459
Comment pep:known_by_projection chromosome:PPYG2:17:48621983:48627786:1 gene:ENSPPYG00000008451 transcript:ENSPPYT00000009878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMRFSSTSRRLGSCGGTGSVRLSSGGAGFGAGNTCSVPGIGSGFSCAFGGSSSAGGYGG
GLGGGSASCAAFTGNEHGLLSGNEKVTMQNLNDRLASYLENVRALEEANADLEQKIKGWY
EKFGPGSCRGLDHDYSRYFPIIDELKNQIISATTSNAHVVLQNDNARLTADDFRLKFENE
LALHQSVEADINGLRRVLDELTLCRTDLEIQLETLSEELAYLKKNHEEEMKALQCAAGGN
VNVEMNAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFNEKSASLQQQISDDAGATTSA
RNELTEMKRTLQTLEIELQSLLATKHSLECSLTETESNYCAQLAQIQAQIGALEEQLHQV
RTETEGQKLEYEQLLDIKVHLEKEIETYCLLIDGEDGSCSKSKGYGGTGNQTKDSSKTTI
VKTVVEEIDPRGKVLSSRVHTVEEKSTKVNNKNEQRVPS
Download sequence
Identical sequences H2NU66
9600.ENSPPYP00000009497 XP_009250084.1.23681 ENSPPYP00000009497 ENSPPYP00000009497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]