SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009498 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009498
Domain Number 1 Region: 315-393
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 9.94e-21
Family Intermediate filament protein, coiled coil region 0.001
Further Details:      
 
Domain Number 2 Region: 81-115
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000214
Family Intermediate filament protein, coiled coil region 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000009498
Domain Number - Region: 197-313
Classification Level Classification E-value
Superfamily Prefoldin 0.00022
Family Prefoldin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009498   Gene: ENSPPYG00000008452   Transcript: ENSPPYT00000009879
Sequence length 468
Comment pep:known_by_projection chromosome:PPYG2:17:48632674:48638274:1 gene:ENSPPYG00000008452 transcript:ENSPPYT00000009879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFRLSGGSRRICSRTGSGRLSGGGTGFVAGNVCVGSGAGSSFSCTLGGISSGGSFCNSS
GGLGSGACAGFLGNEHSLLSGNEKVTMQNLNDRLASYLDHVHALEEANADLEQKIKGWYE
KCEPGSSRGHDHDYSRYFSVTEDLKRQIISATICNASIVLQNDNARLTADDFRLKYENEL
ALHHSVEADTNGLHRVLDELTLCTTDLEIQCETLSEELTYLKKSHEEEMEVLQCTAGGNV
NVEMNATPGVDLTVLLNNMRAEYEDLAEQNRKDAEAWFNERSATLQQQISDHEGAATAAR
NELTELKRNLQTLEIELQSLMAVKHSYECSLAETEGNYCNQLQQIQDQIGVMEEQLQQIR
TETEGQKLEYEQLLDVKMFLEKEIEIYCNLLDGEERKSKSTCYKSKGYRPVNSGNQAKDS
TEETIVKTVVEELDQIGNVLSLRVHSVEEKSSKISNITVEQRVPSKAP
Download sequence
Identical sequences H2NU67
ENSPPYP00000009498 XP_009250085.1.23681 9600.ENSPPYP00000009498 ENSPPYP00000009498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]