SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009535 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009535
Domain Number 1 Region: 118-180
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.71e-18
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009535   Gene: ENSPPYG00000008486   Transcript: ENSPPYT00000009916
Sequence length 382
Comment pep:known_by_projection chromosome:PPYG2:17:49830973:49832121:1 gene:ENSPPYG00000008486 transcript:ENSPPYT00000009916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTRLFSEPGLLSDVPKFASWGDGEDDEPRSDKGDAPPPPPPAPGPGAPGPARAAKPVPL
RGEEGPEATLAEVKEEGELGGEEEEEEEEEEGLDEAEGERPKKRGPKKRKMTKARLERSK
LRRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSG
KRPDLVSYVQTLCKGLSQPTTNLVAGCLQLNSRNFLTEQGADGAGRFHGSGGPFAMHPYP
YPCSRLAGAQCQAAGGLGGGAAHALRTHGYCAAYETLYAAAGGGGASPDYNSSEYEGPLS
PPLCLNGNFSLKQDSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVRGGVHSENLLS
YDMHLHHDRGPMYEELNAFFHN
Download sequence
Identical sequences A0A0D9SCG2 A0A2K5HNJ5 A0A2K5UMJ5 A0A2K6B0W5 F7CUL4 H2NUA3
ENSPPYP00000009535 9544.ENSMMUP00000001878 9600.ENSPPYP00000009535 ENSPPYP00000009535 ENSMMUP00000001878 ENSMMUP00000001878 NP_001252730.1.72884 XP_002827696.1.23681 XP_005584080.1.63531 XP_008011055.1.81039 XP_011723621.1.29376 XP_011785298.1.43180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]