SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009696 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009696
Domain Number 1 Region: 163-402
Classification Level Classification E-value
Superfamily vWA-like 7.56e-72
Family Integrin A (or I) domain 0.00000203
Further Details:      
 
Domain Number 2 Region: 1137-1321
Classification Level Classification E-value
Superfamily Fibronectin type III 6.46e-36
Family Fibronectin type III 0.000003
Further Details:      
 
Domain Number 3 Region: 1518-1719
Classification Level Classification E-value
Superfamily Fibronectin type III 1.12e-34
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 4 Region: 999-1117
Classification Level Classification E-value
Superfamily CalX-like 9.94e-20
Family CalX-beta domain 0.00085
Further Details:      
 
Domain Number 5 Region: 658-743
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.83e-18
Family Integrin beta tail domain 0.0024
Further Details:      
 
Domain Number 6 Region: 61-112
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000366
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 7 Region: 571-609
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000265
Family Integrin beta EGF-like domains 0.019
Further Details:      
 
Domain Number 8 Region: 613-650
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Integrin beta EGF-like domains 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000009696
Domain Number - Region: 541-572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00586
Family Integrin beta EGF-like domains 0.045
Further Details:      
 
Domain Number - Region: 501-527
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0837
Family Integrin beta EGF-like domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009696   Gene: ENSPPYG00000008634   Transcript: ENSPPYT00000010081
Sequence length 1814
Comment pep:known_by_projection chromosome:PPYG2:17:65741823:65786047:1 gene:ENSPPYG00000008634 transcript:ENSPPYT00000010081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVAVPNRAGSEGLESPSWGPRKGQQEGQEGRRKMAGPRPSPWARLLLAALISVSLSGTL
ANRCKKAPVKSCTECVRVDKDCAYCTDEMFRDRRCNTQAELLAAGCQRENIVVMESSFQI
TEETQIDTTLRRSQMSPQGLRVRLRPGEEQHFELEVFEPLESPVDLYILMDFSNSMSDDL
DNLKKMGQNLARVLSQLTSDYTIGFGKFVDKVSVPQTDMRPEKLKEPWPNSDPPFSFKNV
ISLTEDVDEFRNKLQGERISGNLDAPEGGFDAILQTAVCTRDIGWRPDSTHLLVFSTESA
FHYEADGANVLAGIMSRNDERCHLDATGTYTQYRTQDYPSVPTLVRLLAKHNIIPIFAVT
NYSYSYYEKLHTYFPVSSLGVLQEDSSNIVELLEEAFNRIRSNLDIRALDSPRGLRTEVT
SKMFQKTKTGSFHIRRGEVGVYQVQLRALEHVDGTHVCQLPEDQKGNIHLKPSFSDGLKM
DVGIICDVCTCELRKEVRSARCSFNGDFMCGHCVCSEGWSGQTCNCSTGSLSDIQPCLRE
DEDKPCSGRGECQCGHCVCYGEGRYEGQFCEYDNFQCPRTSGFLCNDRGRCSMGQCVCEP
GWTGPSCDCPLSNATCIDSNGGICNGRGHCECGRCHCHQQSLYTDTICEINYSAIHPGLC
EDLRSCVQCQAWGTGEKKGRTCEECNFKVKMVDELKRAEEVVVRCSFRDEDDDCTYSYTM
EGDGAPGPNSTVLVHKKKDCPPGSFWWLIPLLLLLLPLLALLLLLCWKYCACCKACLALL
PCCNRGHMVGFKEDHYMLRENLMASDHLDTPMLRSGSLKGRDVVRWKVTNNMQRPGFATH
AASINPTELAQLRHEVEENLNEVYRQISGVHKLQQTKFRQQPNAGKKQDHTIVDTVLMAP
RSAKPALLKLTEKQVEQRAFHDLKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIR
PEDDEEKQLLVEAIDVPAGTATLGRRLVNITIIKEQARDVVSFEQPEFSVSRGDQVARIP
VIRRVLDGGKSQVSYRTQDGTAQGNRDYIPMEGELLFQPGEAWKELQVKLLELQEVDSLL
RGRQVRRFHVQLSNPKFGAHLGQPHSTTIIIRDPDELDRSFTSQMLSSQPPPHGDLGAPQ
NPNAKAAGSRKIHFNWLPPSGKPMGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYCD
YEMKVCAYGAEGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEIT
AYEVCYGLVNDDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPERE
AIINLATQPKRPMSIPIIPDIPIVDAQSGEDYDSFLMYSDDVLRSPSGSQRPSVSDDTEH
LVNGRMDFAFPGSTNSLHGMTTTSTAAYGTHLSPHVPHRVLSTSSTLTRDYNSLTRSEHS
HSTTLPRDYSTLTSVSSHGLPPIWEHGRSRLPLSWALGSRSRAQMKGFPPSRGPRDSIIL
AGRPAAPSWGPDSRLTAGVPDTPTRLVFSALGPTSLRVSWQEPRCERPLQGYSVEYQLLN
GGELHRLNIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHPQSPL
CPLPGSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDIIGYLVTCEMAQGGGPAT
TFRVDGDSPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDGGPFPQLGSH
AGLFQHPLQSEYSSITTTHTSATEPFLVDGLTLGAQHLEAGGSLTRHVTQEFVSRTLTTS
GTLSTQVDQQFFQT
Download sequence
Identical sequences H2NUQ7
ENSPPYP00000009696 ENSPPYP00000009696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]