SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009728 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009728
Domain Number 1 Region: 2-141
Classification Level Classification E-value
Superfamily Globin-like 3.43e-39
Family Globins 0.000000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009728   Gene: ENSPPYG00000008661   Transcript: ENSPPYT00000010114
Sequence length 161
Comment pep:known_by_projection chromosome:PPYG2:17:66591342:66602571:-1 gene:ENSPPYG00000008661 transcript:ENSPPYT00000010114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGAL
NTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFANDFPPETQR
AWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP
Download sequence
Identical sequences H2NUT8
ENSPPYP00000009728 ENSPPYP00000009728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]