SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009869 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009869
Domain Number 1 Region: 22-128
Classification Level Classification E-value
Superfamily Immunoglobulin 2.5e-20
Family V set domains (antibody variable domain-like) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009869   Gene: ENSPPYG00000008793   Transcript: ENSPPYT00000010262
Sequence length 194
Comment pep:known_by_projection chromosome:PPYG2:17_random:9426:22658:-1 gene:ENSPPYG00000008793 transcript:ENSPPYT00000010262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLSLALLLLILPGYSIAAKITGPTIVNGSERGSLTVQCAYGSGWETYLKWWCQGADWNY
CNILVKTNGSEQEVKKNRVSIRDNQKNHMFTVTMENLKRDDADSYWCGIERPGIDLGVKV
QVTINPDTQTAVPEWTTTTASLAFTAAATQKTSSPLTRSPLSSTHFLFLFLLELPLLLSM
LGTVLWVNRPQRRS
Download sequence
Identical sequences H2NV76
ENSPPYP00000009869 XP_002834147.1.23681 ENSPPYP00000009869 9600.ENSPPYP00000009869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]