SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009881 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000009881
Domain Number - Region: 179-213
Classification Level Classification E-value
Superfamily UBA-like 0.0074
Family CUE domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009881   Gene: ENSPPYG00000008801   Transcript: ENSPPYT00000010274
Sequence length 215
Comment pep:known_by_projection chromosome:PPYG2:17_random:989637:990284:-1 gene:ENSPPYG00000008801 transcript:ENSPPYT00000010274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGEATETVPATEQELPQPQAETGSGTASDSGESVPGLEEQDSTQTTTQKARLVAAAEID
EEPVSKAKQSRSEKRARKAMSKLGLLQVTGVTRVTIWKSKNILFVITKPDVYKSPASDAY
IVFGEAKIQDLSQQAQLAAAEKFKVQGEAVANIQENTQTPTVQEESEEEEVDETGVEVKD
IELVMSQVNVSRAKAVRALKNNSNDIVNAIMELTM
Download sequence
Identical sequences H2NV88
XP_002834153.1.23681 ENSPPYP00000009881 9600.ENSPPYP00000009881 ENSPPYP00000009881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]