SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009902 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009902
Domain Number 1 Region: 284-361
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.27e-22
Family Intermediate filament protein, coiled coil region 0.001
Further Details:      
 
Domain Number 2 Region: 83-116
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000033
Family Intermediate filament protein, coiled coil region 0.0026
Further Details:      
 
Domain Number 3 Region: 89-198
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000262
Family Myosin rod fragments 0.011
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000009902
Domain Number - Region: 166-281
Classification Level Classification E-value
Superfamily Prefoldin 0.0366
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009902   Gene: ENSPPYG00000008820   Transcript: ENSPPYT00000010297
Sequence length 403
Comment pep:novel chromosome:PPYG2:17_random:3149299:3153379:-1 gene:ENSPPYG00000008820 transcript:ENSPPYT00000010297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTTIRQFTSSSSIKGSSGLGGGSSCASCWLSGGLGAGSCRLGSAGGLGSALRGSTYSSC
YRFGSGGGYGSSFGDVDGLLARGEKATMQHLNDRLASYLDKMRTLEEANTELEVKIRDWY
QRQAPGPAHDYSHYYRTIEELQNKFETEQALRLSVEADINGLRRVLDELTLARADLEMHI
ENLKEELAYLKKNHEEMNALRGQVGGEINVEMDAAPGVDLSRILNKMREQYEKMAEKNRK
DAEDWFFSKTEELNREVATNSELVQSGKSEILELQHTMQALEIKLQFQLSVKASLEGNLA
ETENRYCMQLSQIQGLIGSVKEWLAQLRCEMEQQNQEYKILLDVKTRLELEITTYHRLLE
GEDAHLTQYKKEPVTTCQVCTIVEEVQDGKVISSHEQVHQTTR
Download sequence
Identical sequences H2NVA7
ENSPPYP00000009902 9600.ENSPPYP00000009902 ENSPPYP00000009902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]