SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009945 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009945
Domain Number 1 Region: 76-193
Classification Level Classification E-value
Superfamily Lysozyme-like 4.44e-39
Family C-type lysozyme 0.0000397
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009945   Gene: ENSPPYG00000008867   Transcript: ENSPPYT00000010345
Sequence length 194
Comment pep:known_by_projection chromosome:PPYG2:17_random:10341667:10344300:1 gene:ENSPPYG00000008867 transcript:ENSPPYT00000010345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VHSSPVSSPSVSGSRRPVSCLSSQSSALSQSGGGSTSAAGIEARSRALRRRWCPAGIILL
ALISLLSCLLPASEAKVYGRCELARVLHDFGLDGYRGYSLADWVCLAYFTSGFNTAAVDH
EADGSTNNGIFQINSRRWCRNLTPNVPNVCQMYCSDTVICAMKITQEPQGLGWEAWRHHC
QGKDLTEWVDGCDF
Download sequence
Identical sequences H2NVE4
9600.ENSPPYP00000009945 ENSPPYP00000009945 ENSPPYP00000009945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]