SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010024 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010024
Domain Number 1 Region: 33-464
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.44e-73
Family Integrin alpha N-terminal domain 0.00000859
Further Details:      
 
Domain Number 2 Region: 759-995
Classification Level Classification E-value
Superfamily Integrin domains 3.24e-43
Family Integrin domains 0.0025
Further Details:      
 
Domain Number 3 Region: 464-617
Classification Level Classification E-value
Superfamily Integrin domains 1.41e-25
Family Integrin domains 0.0022
Further Details:      
 
Domain Number 4 Region: 618-754
Classification Level Classification E-value
Superfamily Integrin domains 3.35e-22
Family Integrin domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010024   Gene: ENSPPYG00000008931   Transcript: ENSPPYT00000010424
Sequence length 1051
Comment pep:known_by_projection chromosome:PPYG2:17_random:14033680:14072003:1 gene:ENSPPYG00000008931 transcript:ENSPPYT00000010424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGPSRAPRAPRLMLCALALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHR
QTERQQRYLLLAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKSDPGHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDSSDDWQTY
HNEMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKEWDLSEYSYK
DPEDQGNLYIGYTVQVGSAILHPKNITIVTGAPRHRHMGAVFLLSQEAGGDLRRRQVLEG
SQVGAYFGSAIALADLNNDGWQDLLVGAPYYFQRKEEVGGAVYVFMNQAGTSFPAHPSLL
LHGPSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLLRQPQQVIHGE
KLGLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDHIVLLRARPVINIVHKTLVARPAVL
DPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFH
GFFSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQA
QALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNT
RTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAF
EVIGVTLHTRDLQVQLQLSTSSHQDNLWPMTLTLLVDYTLQTSLSMVNHRLQSFFGGTVM
GESGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEITVHG
NGSWPCQPPGDLINPLNLTLSDPGDRPSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSET
VLTCATGRAHCVWLECPIPDAPIVTNVTVKARVWNSTFIEDYRDFDRVRVNGWATLFLRT
SIPTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCGFFK
RARTRALYEAKRQKAEMKSQPSETERLTDDY
Download sequence
Identical sequences H2NVM2
9600.ENSPPYP00000010024 XP_002834330.2.23681 ENSPPYP00000010024 ENSPPYP00000010024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]