SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010028 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010028
Domain Number 1 Region: 455-500
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000647
Family PDZ domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000010028
Domain Number - Region: 573-679
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00222
Family Myosin rod fragments 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010028   Gene: ENSPPYG00000008934   Transcript: ENSPPYT00000010428
Sequence length 729
Comment pep:known_by_projection chromosome:PPYG2:17_random:14116000:14130013:-1 gene:ENSPPYG00000008934 transcript:ENSPPYT00000010428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKTEPRGPGGPLRSASPHRSAYEAGIQALKPPDAPGPDEAPKGAHHKKYGSNVHRIKSM
FLQMGTTAGPSGEAGGGAGLAEAPRASERGVRLSLPRASSLNENVDHSALLKLGTSVSER
VSRFDSKPAPSAQPAPPPHPPSRLQETRKLFERSAPAAATRSAARRLLRQERAGLQDRKL
DVVVRFNGSTEALDKLDADAVSPTVSQLSALFEKADSRTGLHRGPGLPRAAGVPQVNSKL
VSKRSRVFQPPPPPPPAPSGDAPAEKERCPSGQQPPQHRVAPARPPPKPREVRKIKPVEV
EESGESEAESAPGEVIQAEVTVHAALENGSTVATAASPAPEEPKAQAAPEKEAAAVAPPE
RGVGNGRAPDVAPEEVDESKKEDFSEADLVDVSAYSGLGEDSAGSALEEDDEEDEEDGEP
PYEPESGCVEIPGLSEEEDPAPSRKIHFSTAPIQIQVNDLLVEVDGTSLVGVTQSFAASV
LRNTKGRVRFMIGRERPGEQSEVAQLIQQTLEQERWQREMMEQRYAQYGEDDEETGEYAT
DEDEELSPTFPGGEMAIEVFELAENEDALSPVDMEPEKLVHKFKELQIKHAVTEAEIQQL
KRKLQSLEQEKGRWRVEKAQLEQSVEENKERMEKLEGYWGEAQSLCQAVDEHLRETQAQY
QALERKYSKAKRLIKDYQQKEIEFLKKETAQRRVLEESELARKEEMDKLLDKISELEGNL
QTLRNSNST
Download sequence
Identical sequences H2NVM6
9600.ENSPPYP00000010028 ENSPPYP00000010028 ENSPPYP00000010028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]