SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010034 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010034
Domain Number 1 Region: 250-328
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.92e-24
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 
Domain Number 2 Region: 65-99
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000178
Family Intermediate filament protein, coiled coil region 0.0022
Further Details:      
 
Domain Number 3 Region: 140-246
Classification Level Classification E-value
Superfamily Prefoldin 0.00000133
Family Prefoldin 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010034   Gene: ENSPPYG00000008940   Transcript: ENSPPYT00000010434
Sequence length 342
Comment pep:novel chromosome:PPYG2:17_random:14435842:14440274:-1 gene:ENSPPYG00000008940 transcript:ENSPPYT00000010434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYSYRQFSASSFELGGSVRPEVFRAPSIHGSRVSVSSARFVSSSSSGYGGGYGGVLTASD
GLLAGNEKLTMQNLNDRLASYLDKVRALEAANGELEVKIRDWYQKQGPGPSRDYSHYYTT
IQDLRDKNGLRRVLDETTRTDLEMQIEGLKEELAYLKKNPPEEISTLRGQVGGQVSVEVD
SAPGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTD
LRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSER
QNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYSNLSASKVL
Download sequence
Identical sequences H2NVN2
9600.ENSPPYP00000010034 ENSPPYP00000010034 ENSPPYP00000010034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]