SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010060 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010060
Domain Number 1 Region: 346-424
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 8.55e-26
Family Intermediate filament protein, coiled coil region 0.00077
Further Details:      
 
Domain Number 2 Region: 117-150
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000418
Family Intermediate filament protein, coiled coil region 0.0021
Further Details:      
 
Domain Number 3 Region: 228-344
Classification Level Classification E-value
Superfamily Prefoldin 0.00000994
Family Prefoldin 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000010060
Domain Number - Region: 191-229
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0246
Family Intermediate filament protein, coiled coil region 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010060   Gene: ENSPPYG00000008966   Transcript: ENSPPYT00000010461
Sequence length 475
Comment pep:known_by_projection chromosome:PPYG2:17_random:16606344:16610706:-1 gene:ENSPPYG00000008966 transcript:ENSPPYT00000010461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSSRFSSG
GAYGLGGGYGGGFSSSSSFGSGFGGGYGGGLGASFGGGLGGGLGSGFGGGDGLLVGSEKV
TMQNLNDRLASYLDKVRALEEANADLEVKIRDWYQRQRPAEIKDYSPYFKTIEDLRNKIL
TATVDNANVLLQIDNARLAADDFRTKYETELNLRMSVEADINGLRRVLDELTLARADLEM
QIESLKEELAYLKKNHEEEMNALRGQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEK
NRKDAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLEN
SLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRR
LLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN
Download sequence
Identical sequences H2NVQ7
9600.ENSPPYP00000010060 XP_002834383.1.23681 ENSPPYP00000010060 ENSPPYP00000010060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]