SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010233 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000010233
Domain Number - Region: 303-397
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0732
Family LacY-like proton/sugar symporter 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010233   Gene: ENSPPYG00000009112   Transcript: ENSPPYT00000010638
Sequence length 742
Comment pep:known chromosome:PPYG2:18:48225673:48245913:-1 gene:ENSPPYG00000009112 transcript:ENSPPYT00000010638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKLSVILILTFALSVTNPLHELKAAAFPQTTEKISPNWESGINVDLAITTRQYHLQQL
FYRYGENNSLSVEGFRKLLQNIGIDKIKRIHIHHDHEHHSDHEHHSDHEHHSDHEHHSHR
NHAASGKNKRKALCPDHDSDSSGKDPRNSQGKGAHRSEHASGRRNVKDSVSASEVTSTVY
NTVSEGTHFLETIETPRPGKLFPKDVSSSTPPSVTEKSRGSRLAGRKTNESVSEPRKGFM
YSRNTNENPQECFNASKLLTSHGMGIQVPLNATEFNYLCPAIINQIDARSCLIHTSEKKA
EIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMNRVFFKFLLSFLVALAVGTLSGD
AFLHLLPHSHASHHHSHSHEEPAMEMKRGPLFSHLSSQNIEESAYFDSTWKGLTALGGLY
FMFLVEHVLTLIKQFKDKKKKNQKKPENDDDVEIKKQLSKYESQLSTNEEKVDTDDRTEG
YLRAESQEPSHFDSQQPAILEEEEVMIAHHPQEVYNEYVPRGCKNKCHSHFHDTLGQSDD
LIHHHHDYHHILHHHHHQNHHPHSHSQRYSREELKDAGIATLAWMVIMGDGLHNFSDGLA
IGAAFTEGLSSGLSTSVAVFCHELPHELGDFAVLLKAGMTVKQAVLYNALSAMLAYLGMA
TGIFIGHYAENVSMWIFALTAGLFMYVALVDMVPEMLHNDASDHGCSRWGYFFLQNAGML
LGFGIMLLISIFEHKIVFRINF
Download sequence
Identical sequences H2NW72
ENSPPYP00000010233 9600.ENSPPYP00000010233 ENSPPYP00000010233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]