SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010377 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010377
Domain Number 1 Region: 1635-1691
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-17
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 2 Region: 1697-1747
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-17
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 1560-1612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000714
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 1413-1463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000913
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number 5 Region: 237-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000105
Family HkH motif-containing C2H2 finger 0.059
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000010377
Domain Number - Region: 614-647
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000112
Family C2HC finger 0.072
Further Details:      
 
Domain Number - Region: 851-898
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000348
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Domain Number - Region: 1736-1778
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000578
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number - Region: 1537-1569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000721
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number - Region: 195-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00124
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 725-765
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00206
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number - Region: 1045-1075
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00252
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number - Region: 1480-1510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0121
Family Classic zinc finger, C2H2 0.075
Further Details:      
 
Domain Number - Region: 1010-1052
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0206
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number - Region: 528-576
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0274
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number - Region: 705-730
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0704
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010377   Gene: ENSPPYG00000009246   Transcript: ENSPPYT00000010789
Sequence length 2247
Comment pep:known_by_projection chromosome:PPYG2:18:88197004:88699772:1 gene:ENSPPYG00000009246 transcript:ENSPPYT00000010789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDSENKPENDEDEKINKEAQDLTKLSSHNEDGGPVSDVITSFPENSMGKRGFSESSNFD
SVVIGEDRNKHAYKRRKLDEAEPLKSGKQGVCGLETSESSVTEEGIALDETGKETFLSDC
TVGGTCLPNALSPSRNFSTIDVVSLKTDTEKTSAQEMVSLDLERESPFPLKEISVSCTIG
NVDTVLKCSICGHLFSSCSDLEKHAESHMQQSKEHTCCHCSHKAESSSALHMHIKQAHGP
QKVFSCELCGFQCAEENLLNAHYLGKTHLRRQNLAARGGFVQILTKQPFPKKSRTMATKN
VHSKPRTSKPIAKNSDSKGLRNVGSTFKDFRGSISKQSGSSSEFLVEMMPSRNTSSQEVE
IVEEHVTSHGVAQNPENQSKKLDTLVTSEGLLEKLESTKNTLQAAHGISVTSRPRPERNI
LVLGNSFRRRSSTFTLKGQAKKRFNLLGIKRGTSEPQRMYMKHLRTQMKTHDAESVLKHL
EASSSVQRVCVTTSETQEAEQGRGSARPPDSGLDSLTVKPASDSQTLCACTDCGQVATNR
TDLEIHVKRCHAREMKFYCHTCDFSSMSRRDLDEHLHSNQHQQTASVLSCQCCSFISLDE
INLRDHMKEKHNMHFLCTPCNLFFLSEKDMEEHKATEKHINSLVQTKTLQSSNSDLVLQT
LPLSTLESENAKESMDDSGKASQEEPVKSRVSHGNEVRHSSKPQFQCKKCFYKTRSSTVL
TRHIKLRHGQDYHFLCKACNLYSLSKEGMEKHIKRSKHLENAKKNNIGLSFEECIERVCI
GANDKKEEFDVSGNGRIEGHIGVQLQEHSYLEKGMLAPEELSQSGGSTKDDELASTTTPK
RGRPKGNISRTCSHCGLLASSITNLTVHIRRKHSHQYSYLCKVCKYYTVTKGDMERHCAT
KKHKGRVEIEASGKHSSDIIVGPEGGSLEAGKKNAGSAVTMSDEHANKPAESPTSVLEKP
DCGNSVEAEVENVFHSLDGEVNSHLLDKKEQISLEPEDFAQPGDVYSQRDVTDTGENKCL
HCEFSAHSSASLELHVKRKHTKEFEFYCMACDYYAVTRREMTRHAATEKHKMKRQSYLNS
ANIEAGSADMSKNIIMPEEEHQQNSEEFQIISGQPSDTLKSRNAADCCILNENTNLDMSK
VLCAADSVEVETEESNFNEDHSFCETFQQAPVKDKVRKPEEMMSLTVSSNYGSPSRFQNE
NSGSSALNCETAKKNHEISNDAGELRVHCEGEGGSTGDGGGVVPHRHLCPATLDGERSAE
SPALVVTRITRDQGDLESGGQNKVARGHGLEDLKGVQEDPVLENKEILMNSQHETEFILE
EDGPASDSTVESSDVYETIISIDDKGQAMYSFGRFDSSIIRIKNPEDGELIDQSEEGLIA
TGVRISELPLKDCAQGVKKKKSEGSSLGESTRIRCDDCGFLADGLSGLNVHIAMKHPTKE
KHFHCLLCGKSFYTESNLHQHLASAGHMRNEQASVEELPEGGATFKCVKCTEPFDSEQNL
FLHIKGQHEELLREVNKYIVEDTEQINREREENQGNVCKYCGKMCRSSNSMAFLAHIRTH
TGSKPFKCKICHFATAQLGDARNHVKRHLGMREYKCHVCGVAFVMKKHLNTHLLGKHGVG
TPKERKFTCHLCDRSFTEKWALNNHMKLHTGEKPFKCTWPTCHYSFLTASAMKDHYRTHT
GEKSFLCDLCGFAGGTRHALTKHRRQHTGEKPFKCDECNFASTTQSHLTRHKRVHTGEKP
YRCPWCDYRSNCAENIRKHILHTGKHEGVKMYNCPKCDYGTNVPVEFRNHLKEQHPDIEN
PDLAYLHAGIVSKSYECRLKGQGATFVETDSPFTAAALAEEPLVKEKPLRSSRRPAPPPE
QVQQVIIFQGYDGEFALDPSVEETAAATLQTLAMAGQVARVVHITEDGQVIATSQSGAHV
GSVVPGPILPEQLADGATQVVVVGGSMEGHGMDESLSPGGAVIQQVTKQEILNLSEAGVA
PAEASSALDALLCAVTELGEVEGRAGLEEQGRPGAKDVLIQLPGQEVSHVAADPEAPEIQ
MFPQAQESPAAVEVLTQVVHPSAAMASQERAQVAFKKMVQGVLQFAVCDTAAAGQLVKDG
VTQVVVSEEGAVHMVAGEGAQIIMQEAQGEHMDLVESDGEISQIIVTEELVQAMVQESGG
GFSEGATHYIVTELPPGVQDEPGLYSHTVLETADSQELLQAGATLGTEAGAPSRAEPLAS
VVIYTQEGSPAAAAIQSQRESSEPQEA
Download sequence
Identical sequences H2NWL2
XP_002828365.1.23681 ENSPPYP00000010377 ENSPPYP00000010377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]