SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010388 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010388
Domain Number 1 Region: 1002-1054
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 383-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000147
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 641-692
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000467
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 4 Region: 678-727
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000662
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010388   Gene: ENSPPYG00000009253   Transcript: ENSPPYT00000010800
Sequence length 1191
Comment pep:known_by_projection chromosome:PPYG2:18:92776828:92782421:1 gene:ENSPPYG00000009253 transcript:ENSPPYT00000010800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APGEGADDADSGPESRSGSEETSVCEKCCAEFFKWADFLEHQRSCTKLPPVLIVHEDAPA
PPPEDFPEPSPASSPSEHAESEAAEEAGVEGAEGEARPVEKEAEPMDAEPAGDTRAPRPP
PAAPAPPTPAYGAPSTNVTLEALLSTKVAVAQFSQGARAAGGSGAGGGVAAAAVPVILEQ
LMALQQQQIHQLQLIEQIRSQVALMQRPPPRPSLSPAAAPSAPGPAASQLPGLAALPLSA
GTPAAPAAFEGAQPLSRPESGTSTPGGPAEPSAPTAPSAAPAPAAPAPAPAPQSAASSQP
QSASTPPALAPGSLLGSAPGLPSPLLPQTSASGVIFPNPLVSIAATANALDPLSALMKHR
KGKPPNVSVFEPKASAEDPFFKHKCRFCAKVFGSDSALQIHLRSHTGERPFKCNICGNRF
STKGNLKVHFQRHKEKYPHIQMNPYPVPEYLDNVPTCSGIPYGMSLPPEKPVTTWLDSKP
VLPTVPTSAGLQLPPTVPGAHGYADSPSATPASRSPQRPSPASSECASLSPGLNHTESGV
SATAESPQPLLGGPPLTKAEPVSLPCTNARAGDAPVGAQASATPTSVDGAPTSLGSPGLP
AVSEQFKAQFPFGGLLDSMQTSETSKLQQLVENIDKKMTDPNQCVICHRVLSCQSALKMH
YRTHTGERPFKCKICGRAFTTKGNLKTHFGVHRAKPPLRVQHSCPICQKKFTNAVVLQQH
IRMHMGGQIPNTPLPEGFQDAMDSELAYDDKNAETLSSYDDDMDENSMEEDAELKDAASD
PVKPLLSYAGSCPPSPPSVISSIAALENQMKMIDSVMSCQQLTGLKSVENGSGESDRLSN
DSSSAVGDLESRSAGSPALSESSSSQALSPVPSNGESFRSKSPGLGAPEEPQEIPLKTER
PDSPAPAPGSGGAPGRAGIKEEVPFSLLFLSRERGPSQSTPSLVSSAAPTMIKMEVNGHG
KAMALGEGPPLPAGIQVPAGPQTVMGPGLAPMLAPPPRRTPKQHNCQSCGKTFSSASALQ
IHERTHTGEKPFGCTICGRAFTTKGNLKVHMGTHMWNNAPARRGRRLSVENPMALLGGDA
LKFSEMFQKDLAARAMNVDPSFWNQYAAAITNGLAMKNNEISVIQNGGIPQLPVSLGGSA
LPPLGTMASGMDKARTGSSPPIVSLDKASSETAASRPFTRFIEDNKEIGIN
Download sequence
Identical sequences H2NWM3
9600.ENSPPYP00000010388 ENSPPYP00000010388 ENSPPYP00000010388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]