SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010462 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010462
Domain Number 1 Region: 302-426
Classification Level Classification E-value
Superfamily TIMP-like 4.71e-21
Family Tissue inhibitor of metalloproteinases, TIMP 0.017
Further Details:      
 
Domain Number 2 Region: 35-86
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000458
Family TSP-1 type 1 repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010462   Gene: ENSPPYG00000009322   Transcript: ENSPPYT00000010875
Sequence length 428
Comment pep:known_by_projection chromosome:PPYG2:19:1447057:1452797:-1 gene:ENSPPYG00000009322 transcript:ENSPPYT00000010875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSAPLFPRPRLFQNLLLFLWALLNCSLGVSAQGPGEWTPWVSWTRCSSSCGRGVSVRSR
RCLRLPGEEPCWGDSHEYRLCQLPDCPPGAVPFRDLQCALYNGRPVLGTQKTYQWVPFHG
SAGCDGLLGSGALEDRCGRCGGANDSCLFVQRVFRDAGAFAGYWNVTLIPEGARHVRVAH
RSRNHLALMGGDGRYVLNGDWTVSPPGTYEAAGTHVVYTRDTGPQETLQAAGPTSHDLLL
QVLLQEPNPGIEFEFWLPRERYSPFQARVQALGWPLRQPQPRGVEPQPPAAPAVTPARTP
TLAPDPCPPCPDTRGRAHRLLHYCGSDFVFQARVLGRHRQAQETRYEVRIQLVYKNRSPL
RAREYVWAPGHCPCPMLAPYRDYLMAVQRLVSPDGTQDQLLLPHAGYARPWSPAEDSRIR
LTARRCPS
Download sequence
Identical sequences H2NWU5
ENSPPYP00000010462 ENSPPYP00000010462 9600.ENSPPYP00000010462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]