SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010467 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010467
Domain Number 1 Region: 489-557
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000615
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010467   Gene: ENSPPYG00000009327   Transcript: ENSPPYT00000010880
Sequence length 603
Comment pep:known_by_projection chromosome:PPYG2:19:1557361:1594160:-1 gene:ENSPPYG00000009327 transcript:ENSPPYT00000010880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGVQFGGSGKSGERGAYASF
GRDAGVGGLTQAGFLSGELALSSPGPLSPSGMKGTSQYYTSYSGSSRRRAADGSLDTQPK
KVRKVPPGLPSSVYPPSSGDEYSRVTATYPSPKTPSSAYPAPFYMADGSLHPSAELWSPP
GQAGFGPMLGGGSSPLHLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSAS
SFSSAPGATYGGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSS
SPSTPVGSPQGLAGTSQWPRAGASGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGT
AGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGGHPEDGLAGSTSLMHNHAALPSQPGA
LPDLSRPPDSYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSPD
EDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLI
LHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAAHPGLSEAHNPA
GHM
Download sequence
Identical sequences H2NWV0
9600.ENSPPYP00000010467 ENSPPYP00000010467 ENSPPYP00000010467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]