SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010495 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010495
Domain Number 1 Region: 401-528
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 1.27e-24
Family Lamin A/C globular tail domain 0.00022
Further Details:      
 
Domain Number 2 Region: 301-377
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.08e-18
Family Intermediate filament protein, coiled coil region 0.00012
Further Details:      
 
Domain Number 3 Region: 25-58
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000188
Family Intermediate filament protein, coiled coil region 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000010495
Domain Number - Region: 108-209
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000915
Family Myosin rod fragments 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010495   Gene: ENSPPYG00000009353   Transcript: ENSPPYT00000010908
Sequence length 531
Comment pep:known_by_projection chromosome:PPYG2:19:2415754:2442209:-1 gene:ENSPPYG00000009353 transcript:ENSPPYT00000010908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPLAGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELENDRLLLKISE
KEEVTTREVSGIKALYESELADARRVLDETARERARLQIEIGKLRAELDEVNKSAKKREG
ELTVAQGRVKDLESLFHRSEVELAAALSDKRGLESDVAELRAQLAKAEDGHAVAKKQLEK
ETLMRVDLENRCQSLQEELDFRKSVFEEEVRETRRRHERRLVEVDSSRQQEYDFKMAQAL
EELRSQHDEQVRLYKLELEQTYQAKLDSAKLSSDQNDKAASAAREELKEARMRLESLSYQ
LSGLQKQASAAEDRIRELEEAMAGERDKFRKMLDAKEQEMTEMRDVMQQQLAEYQELLDV
KLALDMEINAYRKLLEGEEERLKLSPSPSSRVTVSRATSSSRGSMSATGRLGRSKRKRLE
VEEPLGSGPSVLGTGTGGSGGFHLAQQASASGSVSIEEIDLEGKFVQLKNNSDKDQSLGN
WRIKRQVLEGEEIAYKFTPKYVLRAGQMVTEEDLFHQQGDPRTTSRGCYVM
Download sequence
Identical sequences H2NWX7
ENSPPYP00000010495 9600.ENSPPYP00000010495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]