SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010501 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010501
Domain Number 1 Region: 319-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.35e-24
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 2 Region: 403-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.76e-24
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 207-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-22
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 4 Region: 263-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-21
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 5 Region: 449-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 2-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.03e-19
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 7 Region: 165-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 366-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000434
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000010501
Domain Number - Region: 138-174
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00257
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010501   Gene: ENSPPYG00000009360   Transcript: ENSPPYT00000010915
Sequence length 543
Comment pep:known_by_projection chromosome:PPYG2:19:2843767:2859945:1 gene:ENSPPYG00000009360 transcript:ENSPPYT00000010915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVVFEDVAVDFTMEEWALLDSAQRDLYRDVMLETFENLASVDDETQFKASGSVSQQDI
YGEKIPKKSKIAAFTRNVSLASVLGKIWDSLSIEDHPTNQGQNLRNHVLERLCESNDQCG
EAVSQVPHLNLYKKILPGVKQYEYNTYRKVFMHRRASLKSPITVHTGRKPYQCQECGQAY
SCRSHLRMHVRTHNGERPYVCKLCGKTFPRTSSLNRHVRIHTAEKTYECKQCGKAFIDFS
SLTSHLRSHTGEKPYKCKECGKAFSYSSTFRRHTITHTGEKPYKCKDCGEAFSYSSTFRR
HMISHTGEKPHKCKECGEAFSYSSAFRRHMITHTGEKPYECKQCGKTFIYLQSFRRHERI
HTGEKPYECKQCGKTFIYPQSFRRHERTHGGEKPYECNQCGKAFSHPSSFRGHMRVHTGE
KPYECKQCGKTFNWPISLRKHMRTHTREKPYECKECGKVFKWPSSLPIHMRLHTGEKPYQ
CKHCGKAFNCSSSLRRHVRIHTTEKQYKCNVGHPPANEFMCSASEKSHQERDLIKVVNMV
LPL
Download sequence
Identical sequences H2NWY3
ENSPPYP00000010501 ENSPPYP00000010501 9600.ENSPPYP00000010501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]