SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010502 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010502
Domain Number 1 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.6e-24
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 2 Region: 248-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 332-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 4 Region: 2-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.49e-20
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 5 Region: 460-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 210-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000356
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 7 Region: 509-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000167
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 295-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000156
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 9 Region: 379-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000016
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 10 Region: 100-151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000149
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000010502
Domain Number - Region: 140-189
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00204
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010502   Gene: ENSPPYG00000009361   Transcript: ENSPPYT00000010916
Sequence length 545
Comment pep:known_by_projection chromosome:PPYG2:19:2952348:2968363:-1 gene:ENSPPYG00000009361 transcript:ENSPPYT00000010916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVVFEEVAVNFTPEEWALLDHAQRSLYRDVMLETCRNLASLDCCIYVRTSGSSSQRDV
FGNGISNDEEIVKFTRSDSWSIFGENWRFDNIGDQRQSPERHLRSQLGSLCESNDGHQCG
ETLSQTANLLVHKSYPTEAKPSECAKCGKAFENRQRSHTGQRVCKECGQACSCLSCQSPS
MKMQTVEKPCNCQDSRRASATYVKSLSSKKSYECKKCGKAFTCPSSFRGHVNSHHGQKTH
ACKVCGKTFMYYSYLTRHVRTHTGEKPYECKECGKAFSCPSYFREHVRTHTGEKPYECKH
CGKSFSCYSSFRDHVRTHTGEKPCQCKHCGKAFTCYSSLREHGRTHSGEKPYDCKECGKA
FRYPSSLRAHVRMHTGEKPYVCKQCGKAFGCPTYFRRHVKTHSGVKPYECKECGKAYSFS
SSLRIHVRTHTGEKPFECKHCGKAFSCHSSLREHVRTHSGEKPYECNQCGKAFSHAQYFQ
KHVRSHSGVKPYECTECGKAYSCSSSLRVHVRTHTGERPYECKQCGKTFRYLASLQAHVR
THAGV
Download sequence
Identical sequences H2NWY4
ENSPPYP00000010502 ENSPPYP00000010502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]