SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010554 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010554
Domain Number 1 Region: 100-517
Classification Level Classification E-value
Superfamily Sema domain 2.62e-111
Family Sema domain 0.00000259
Further Details:      
 
Domain Number 2 Region: 513-556
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000012
Family Plexin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010554   Gene: ENSPPYG00000009412   Transcript: ENSPPYT00000010968
Sequence length 876
Comment pep:known_by_projection chromosome:PPYG2:19:4525386:4560943:-1 gene:ENSPPYG00000009412 transcript:ENSPPYT00000010968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIEGAGDVACPLQWPHQAGVRSLLGLPGLGLEDRNQTALGKVTMTSACRTGVTSCRLAL
AMQTPRASPPRSALLLLLLLLGGAHGLFPEEPPPLSVAPRDYLNHYPVFVGSGPGRLTPA
EGADDLNIQRVLRVNRTLFVGDRDNLYRVELEPPTSTELRYQRKLTWRSNPSDINVCRMK
GKQEGECRNFVKVLLLRDESTLFVCGSNAFNPVCANYSIDTLQPVGDNISGMARCPYDPK
HANVALFSDGMLFTATVTDFLAIDAVIYRSLGDRPTLRTVKHDSKWFKEPYFVHAVEWGS
HVYFFFREIAMEFNYLEKIPGSAVCAFDMTQVAAVFEGRFREQKSPESIWTPVPEDQVPR
PRPGCCAAPGMQYNASSALPDDILNFVKTHPLMDEAVPSLGHAPWIVRTLMRHQLTRVAV
DMGAGPWGNQTVVFLGSEAGTVLKFLVRPNASTSGTSGLSVFLEEFETYRPDRCGRPGSG
ETGQRLLSLELDAASGGLLAAFPRCVVRVPVARCQQYSGCMKNCIGSQDPYCGWAPDGSC
IFLSPGTRAAFEQDVSGASTSGLGDCTGLLRASLSEDRAGLVSVNLLVTSSVAAFVVGAV
VSGFSVGWFVGLRERRELTRRKDKEAILAHGAGEAVLSVSRLGERRAQGPGGRGGGGGGG
AGVPPEALLAPLMQNGWAKATLLQGGPHDLDSGLLPTPEQTPLPQKRLPTPHPHPHALGP
RAWDHGHPLLPASASSSLLLLAPARAPEQPPAPGEPTTDGRLYAARPGRASHGDFPLTPH
ASPDRRRVVSAPTGPLDPASAADGLPRPWSPPPTGSLRRPPGPHAPPAATLRRTHTFNSG
EARPGDRHRGCHARPGTDLAHLLPYGGADRTAPPVP
Download sequence
Identical sequences H2NX35
ENSPPYP00000010554 ENSPPYP00000010554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]