SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010624 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010624
Domain Number 1 Region: 384-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.31e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 329-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-19
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 272-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.52e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 426-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-18
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 5 Region: 234-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.74e-17
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010624   Gene: ENSPPYG00000009476   Transcript: ENSPPYT00000011041
Sequence length 636
Comment pep:known_by_projection chromosome:PPYG2:19:7670108:7675556:1 gene:ENSPPYG00000009476 transcript:ENSPPYT00000011041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAAAGAGELQVPAAPAAALGRSLSLPGSAWRGRWAEGAAGRSGGRGASCGPGGSRRPA
RARRARQGRGAPGLAPEAAGTSTPEMRRSVLVRNPGHKGLRPVYEELDSDSEDLDPNPED
LDPVSEDPEPDPEDLNTVPEDVDPNYEDLEPVSEDLDPDAEAPGSEPQDPDPMSSSFDLD
PDVIGPVPLILDPNSDTLSPGDPSVDPISSGLTATPQVLATSPAVLPAPASPPRPFSCPD
CGRAFRRSSGLSQHRRTHSGEKPYRCPDCGKSFSHGATLAQHRGIHTGARPYQCAACGKA
FGWRSTLLKHRSSHSGEKPHHCPVCGKAFGHGSLLAQHLRTHGGPRPHKCPVCAKGFGQG
SALLKHLRTHTGERPYPCPQCGKAFGQSSALLQHQRTHTAERPYRCPHCGKAFGQSSNLQ
HHLRIHTGERPYACPHCSKAFGQSSALLQHLHVHSGERPYRCQLCGKAFGQASSLTKHKR
VHEGAAAAAAAAGLGLGPGLSPASVMRPGQVSLLGPDAVSVLGSGLGLSPGTSSGRNPDP
GSGPGTLPDPSSKPLPGSRSTPSPTPVESSDPKAGHDDDPDLVPSPDPDPVPSPDPNPVS
CPDPCSPTRGPVSPALPTGESPEWVQAQGALLGPDG
Download sequence
Identical sequences H2NXA4
ENSPPYP00000010624 ENSPPYP00000010624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]