SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010668 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010668
Domain Number 1 Region: 236-456
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.54e-57
Family Reprolysin-like 0.0003
Further Details:      
 
Domain Number 2 Region: 546-601
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000209
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 3 Region: 888-944
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000327
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 4 Region: 825-884
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 5 Region: 943-1002
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000471
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 6 Region: 1001-1054
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000628
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010668   Gene: ENSPPYG00000009510   Transcript: ENSPPYT00000011085
Sequence length 1067
Comment pep:known_by_projection chromosome:PPYG2:19:8805892:8827112:-1 gene:ENSPPYG00000009510 transcript:ENSPPYT00000011085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPACQILRWALALGLGLMFEVTHAFRSQDEFLSSLESYEIAFPTRVDHNGALLAFSPPP
PRRQRRGTGATAESRLFYKVASPSTHFLLNLTHSSRLLAGHVSVEYWTREGLAWQRAARP
HCLYAGHLQGQASSSHVAISTCGGLHGLIVADEEEYLIEPLHGGPKGSRGPEESGPHVVY
KRSSLRHPHLDTACGVRDEKPWKGRPWWLRTLKPPPARPLGNETERGQPGLKRSVSRERY
VETLVVADKMMVAYHGRRDVEQYVLAIMNIVAKLFQDSSLGSTVNILVTRLILLTEDQPT
LEITHHAGKSLDSFCKWQKSIVNHSGHGNAIPENGVANHDTAVLITRYDICIYKNKPCGT
LGLAPVGGMCERERSCSVNEDIGLATAFTIAHEIGHTFGMNHDGVGNSCGARGQDPAKLM
AAHITMKTNPFVWSSCSRDYITSFLDSGLGLCLNNRPPRQDFVYPTVAPGQAYDADEQCR
FQHGVKSRQCKYGEVCSELWCLSKSNRCITNSIPAAEGTLCQTHTIDKGWCYKRVCVPFG
SRPEGVDGAWGPWTPWGDCSRTCGGGVSSSSRHCDSPRPTIGGKYCLGERRRHRSCNTDD
CPPGSQDFREVQCSEFDSIPFRGKFYTWKTYRGGGVKACSLTCLAEGFNFYTERAAAVVD
GTPCRPDTVDICVSGECKHVGCDRVLGSDLREDKCRVCGGDGSACETIEGVFSPASPGAG
YEDVVWIPKGSVHIFIQDLNLSLSHLALKGEQESLLLEGLPGIPQPHRLPLAGTTFQLRQ
GPDQVQSLEALGPINASLIVMVLARTELPALRYRFNAPIARDSLPPYSWHYAPWTKCSAQ
CAGGSQVQAVECRNQLDSSAVAPHYCSAHSKLPKRQRACNTEPCPPDWVVGNWSLCSRSC
DAGVRSRSVVCQRRVSAAEEKALDDSACPQPRPPVLEACHGPTCPPEWAALDWSECTPSC
GPGLRHRVVLCKSADHRATLPPAHCSPAAKPPATMRCNLRRCPPARWVAGEWGECSAQCG
VGQRQRSVRCTSHTGQASHECTEALRPPTTQQCEAKCDSPTPGDGPE
Download sequence
Identical sequences H2NXE8
ENSPPYP00000010668 ENSPPYP00000010668 9600.ENSPPYP00000010668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]