SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010745 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010745
Domain Number 1 Region: 404-517
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.28e-17
Family Mannose 6-phosphate receptor domain 0.0072
Further Details:      
 
Domain Number 2 Region: 68-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000419
Family LDL receptor-like module 0.0048
Further Details:      
 
Domain Number 3 Region: 209-259
Classification Level Classification E-value
Superfamily EF-hand 0.0000509
Family Calmodulin-like 0.08
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000010745
Domain Number - Region: 31-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000209
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number - Region: 127-220
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00837
Family FCH domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010745   Gene: ENSPPYG00000009582   Transcript: ENSPPYT00000011166
Sequence length 534
Comment pep:known_by_projection chromosome:PPYG2:19:11612603:11629502:1 gene:ENSPPYG00000009582 transcript:ENSPPYT00000011166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPLLLLLPMCWAVEVKRPRGVSLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKD
GSDEPGTAACPNGSFHCTNTGYKPLYIPSNRVNDGVCDCCDGTDEYNSGVICENTCKEKG
RKERESLQQMAEVTREGFRLKKILIEDWKKAREEKQKKLIELQAGKKSLEDQVEMLRTVK
EEAEKPEREAKEQHQKLWEEQLAAAKAQREQELAADAFKELDDDMDGTVSVTELQTHPEL
DTDGDGALSEAEAQALLSGDTQTDATSFYDRVWAAIRDKYRSEALPTDLPAPSAPDLTEP
KEEQPPVPSPPTEEEEEEEEEEEAEEEEEEEDSEVQGEQPKEAPPPLSPPQPASPAEEDK
MPPYDEQTQAFIDAAQEARNKFEEAERSLKDMEESIRNLEQEISFDFGPNGEFAYLYSQC
YELTTNEYVYRLCPFKLVSQKPKLGGSPTSLGTWGSWAGPDHDKFSAMKYEQGTGCWQGP
NRSTTVRLLCGKDTMVTSTTEPSRCEYLMELMTPAACAEPPPPEAPTEDDHDEL
Download sequence
Identical sequences H2NXM2
ENSPPYP00000010745 ENSPPYP00000010745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]