SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010749 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010749
Domain Number 1 Region: 344-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 231-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 2-54
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-21
Family KRAB domain (Kruppel-associated box) 0.00046
Further Details:      
 
Domain Number 4 Region: 387-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.94e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 5 Region: 175-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.43e-20
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 6 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-19
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 7 Region: 137-189
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000123
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000010749
Domain Number - Region: 96-136
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000476
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010749   Gene: ENSPPYG00000009586   Transcript: ENSPPYT00000011170
Sequence length 461
Comment pep:known_by_projection chromosome:PPYG2:19:11760876:11784006:1 gene:ENSPPYG00000009586 transcript:ENSPPYT00000011170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVAFEDVAVNFTLEEWALLDPSQKNLYRDVMRETFRNLASIGKQWEDQNIEDPFKIPR
RNISHIPERLCESKEGGQGEETFSQIPDGILNKKTPGVKPCESSVCGEVGMGPSSLNRHI
RDHTGREPNEYQEYGKKSYTRNQCGRALSYHRSFPVRERTHPGGKPYDCKECGETFISLV
SIRRHMLTHRGGVPYKCKVCGKAFDYPSLFRIHERSHTGEKPYECKQCGKAFSCSSYIRI
HERTHTGDKPYECKQCGKAFSCSKYIRIHERTHTGEKPYECKQCGKAFRCASSVRSHERT
HTGEKLFECKECGKALTCLASVRRHMIKHTGNGPYKCKVCGKAFDFPSSFRIHERTHTGE
KPYDCKQCGKAFSCSSSFRKHERIHTGEKPYKCTKCGKAFSRSSYFRIHERTHTGEKPYE
CKQCGKAFSRSTYFRVHEKIHTGEKPYENPNPNPSVVPVLS
Download sequence
Identical sequences H2NXM6
ENSPPYP00000010749 XP_009251086.1.23681 ENSPPYP00000010749 9600.ENSPPYP00000010749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]