SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010755 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010755
Domain Number 1 Region: 316-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.24e-23
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 261-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.38e-23
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 3 Region: 428-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.29e-22
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 4 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-21
Family KRAB domain (Kruppel-associated box) 0.00051
Further Details:      
 
Domain Number 5 Region: 204-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 372-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 470-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-17
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 8 Region: 149-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5e-17
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010755   Gene: ENSPPYG00000009593   Transcript: ENSPPYT00000011177
Sequence length 540
Comment pep:known chromosome:PPYG2:19:12354159:12383614:1 gene:ENSPPYG00000009593 transcript:ENSPPYT00000011177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVAFEDVDVNFTQEEWALLDPSQKNLYRDVMWETMRNLASVGKKWKDQNIKDHYKHRG
RNLRSHMLERLYQTKDSSQRGGIFSQFANQNLSKKIPGVKLCESIVYGEVSMGQSSLNRH
IKDHSGHEPKKYQEYGEKPDTRNQCWKPFSSHHSFRTHEIIHTGEKLYDCKECGKTFFSL
KRIRRHIITHSGYTPYKCKVCGKAFDYPSRFRTHERSHTGEKPYECKECGKAFTCITSVR
RHMIKHTGDGPYKCKVCGKPFHSLSSFQVHERIHTGEKPFKCKQCGKAFSCSPTLRIHER
THTGEKPYECKQCGKAFSYLPSLRLHERIHTGEKPFVCKQCGKAFRSASTFQIHERTHTG
EKPYECKECGEAFSCIPSMRRHMIKHTGEGPYKCKVCGKPFHSLSPFRIHERTHTGEKPY
VCKHCGKAFVSSTSIRIHERTHTGEKPYECKQCGKAFSYLNSFRTHEMIHTGEKPFECKR
CGKAFRSSSSFRLHERTHTGQKPYHCKECGKAYSCRASFQRHMLTHAEDGPPYKCMWESL
Download sequence
Identical sequences H2NXN2
9600.ENSPPYP00000010755 ENSPPYP00000010755 ENSPPYP00000010755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]