SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010756 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010756
Domain Number 1 Region: 459-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.17e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 180-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 3 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.91e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 124-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-20
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 336-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.22e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 501-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 7 Region: 403-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.57e-17
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 8 Region: 293-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.73e-17
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 9 Region: 86-136
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000239
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010756   Gene: ENSPPYG00000009594   Transcript: ENSPPYT00000011178
Sequence length 562
Comment pep:known_by_projection chromosome:PPYG2:19:12470409:12475643:-1 gene:ENSPPYG00000009594 transcript:ENSPPYT00000011178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISPKSRGNSRCDVVERFGKSKDGSQCGETLSQIRNSIVNKNTPTKVDACGSSVNGEFIM
GHSSLNCYIRVDTGHKHQECHKYAEKPYTHKQCGKGLSYRHSFQTRERPHTGKKLYDCKE
CGKTFSSPGNLRRHMVVKGGDGPYKCELCGKAFFWPSLLRMHERTHTGEKPYECKHCSKA
FPVYSSYLRHEKIHTGEKPYECKQCSRAFPDYSSYLRHERTHTGEKPYKCKQCGKAFSVS
GSLRVHERIHTGEKPYTCKQCGKAFCHLGSFQRHMIMHSGDGPHKCKICGKGFDFPGSAR
IHEGTHTLEKPYECKQCGKLLSHRSSFRRHMMAHTGDGPHKCTVCGKAFDSPSVFRRHER
THTGEKPYECKQCGKAFRTSSSLRKHETTHTGEQPYKCKCGKAFSDFFSFQNHETTHSEE
EPYECKECGKAFSSFKYFCRHERTHSEEKSYECQICGKAFSRFSYLKTHERTHTAEKPYE
CKQCRKAFFWPSFLLRHERTHTGERPYECKHCGKAFSRSSFCREHERTHTGEKPYECKEC
GKAFSSLSSFNRHKRTHWKDIL
Download sequence
Identical sequences H2NXN3
ENSPPYP00000010756 ENSPPYP00000010756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]