SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010776 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010776
Domain Number 1 Region: 293-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.72e-16
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 326-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000741
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010776   Gene: ENSPPYG00000009612   Transcript: ENSPPYT00000011198
Sequence length 362
Comment pep:known_by_projection chromosome:PPYG2:19:13105853:13108100:-1 gene:ENSPPYG00000009612 transcript:ENSPPYT00000011198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAETALPSISTLTALGPFPDTQDDFLKWWRSEEAQDMGPGPPDPTEPPLHVKSEDQPG
EEEDDERGADATWDLDLLLTNFSGPEPGGAPQTCALAPSEAPGAQYPPPPETLGAYAGGP
GLVAGLLGSEDHSGWVRPALRAPAPDAFVGPALAPAPAPEPKALALQPVYPGPGAGSSGG
YFPRTGLSVPAASGAPYGLLSGYSAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLSCLG
PGTVGTGLGGTAEDPGVIAEAAPSKRGRRSWARKRQAAHTCVHPGCGKSYTKSSHLKAHL
RTHTGEKPYACTWEGCGWRFARSDELTRHYRKHTGQRPFRCQLCPRAFSRSDHLALHMKR
HL
Download sequence
Identical sequences H2NXQ2
XP_002828790.1.23681 ENSPPYP00000010776 ENSPPYP00000010776 9600.ENSPPYP00000010776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]