SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010818 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010818
Domain Number 1 Region: 402-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.09e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 458-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.34e-24
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 197-257
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.42e-23
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 4 Region: 545-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.69e-22
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 584-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.94e-18
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 364-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 2-55
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000262
Family KRAB domain (Kruppel-associated box) 0.003
Further Details:      
 
Domain Number 8 Region: 505-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000298
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 9 Region: 306-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000309
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010818   Gene: ENSPPYG00000009652   Transcript: ENSPPYT00000011240
Sequence length 665
Comment pep:known_by_projection chromosome:PPYG2:19:14852523:14885340:1 gene:ENSPPYG00000009652 transcript:ENSPPYT00000011240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESVTFEDVAVEFIQEWALLDSARRRLCRYRMLDQCRTLASRGTPPCKPSCVSQLGPRAE
PRATEQGILHATGVAWESQLKPKELPSMQDLLEEASSRDMQMGPGLFLRMQLVPSIEERE
TPLTREDWPALQEPPWSPGCMGLKAAVQIQRVVIPVPTLSHCNPWVARDSAVPARDPAWL
QEDKVEEEAMAPGLPTACSQEPVTFADVAVVFTPEEWVFLDSTQRSLYRDVMLENYRNLA
SVADQLCKPNALSYLEERGEQWTTDRGILSDTCAEPQCQPQEAIPSQDTFTEILSLDVKG
EQPQPGEKLYKYNELEKPFNSIEPLFQYQRIHAGEASYECQEIRNSFFQSAHLIVPEKIR
SGDKTYACNKCEKSFRYSSDLIRHEKTHTAEKCFDCQECGQAFKYSSNLRRHMRTHTGEK
PFECSQCGKTFTRNFNLILHQRNHTGEKPYECKDCGKAFNQPSSLRSHVRTHTGEKPFEC
SQCGKAFREHSSLKTHLRTHTREKPYECNQCGKPFRTSTHLNVHKRIHTGEKLYECGTCG
QVLSRLSTLKSHMRTHTGEKPYVCQECGRAFSEPSSLRKHARTHSGKKPYACQECGRAFG
QSSHLIVHVRTHSAGRPYQCNQCEKAFRHSSSLTVHKRTHVGRENIRNGSLPLSMSHPYC
GPLAN
Download sequence
Identical sequences H2NXU3
ENSPPYP00000010818 9600.ENSPPYP00000010817 ENSPPYP00000010818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]