SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010835 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010835
Domain Number 1 Region: 1779-2024
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.28e-54
Family Ankyrin repeat 0.000000063
Further Details:      
 
Domain Number 2 Region: 570-699
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000476
Family Growth factor receptor domain 0.008
Further Details:      
 
Domain Number 3 Region: 388-511
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000119
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 1054-1164
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000126
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 798-933
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000138
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 6 Region: 507-549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000409
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 7 Region: 236-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000154
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 920-962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000949
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 9 Region: 1174-1215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000113
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 158-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000116
Family EGF-type module 0.0021
Further Details:      
 
Domain Number 11 Region: 274-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 12 Region: 927-1040
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000022
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 13 Region: 1338-1374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000322
Family EGF-type module 0.018
Further Details:      
 
Domain Number 14 Region: 1467-1500
Classification Level Classification E-value
Superfamily Notch domain 0.0000000798
Family Notch domain 0.0035
Further Details:      
 
Domain Number 15 Region: 692-732
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000179
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 16 Region: 311-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000196
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 17 Region: 1248-1296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000201
Family EGF-type module 0.01
Further Details:      
 
Domain Number 18 Region: 121-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000298
Family EGF-type module 0.017
Further Details:      
 
Domain Number 19 Region: 42-78
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000322
Family EGF-type module 0.038
Further Details:      
 
Domain Number 20 Region: 353-395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000339
Family EGF-type module 0.017
Further Details:      
 
Domain Number 21 Region: 735-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000357
Family EGF-type module 0.012
Further Details:      
 
Domain Number 22 Region: 198-240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000795
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 23 Region: 1386-1418
Classification Level Classification E-value
Superfamily Notch domain 0.00000101
Family Notch domain 0.0014
Further Details:      
 
Domain Number 24 Region: 1426-1458
Classification Level Classification E-value
Superfamily Notch domain 0.00000209
Family Notch domain 0.0049
Further Details:      
 
Domain Number 25 Region: 80-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000164
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000010835
Domain Number - Region: 773-810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000126
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 1205-1245
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000286
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 1291-1325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0145
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010835   Gene: ENSPPYG00000009668   Transcript: ENSPPYT00000011258
Sequence length 2321
Comment pep:known_by_projection chromosome:PPYG2:19:15496347:15539751:-1 gene:ENSPPYG00000009668 transcript:ENSPPYT00000011258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGARGRRRRRCPMSPPPPPPPVRALPLLLLLAGPGAAAPPCLDGSPCANGGRCTQLPS
REAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLP
DPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCRSDVDECRVGEPCRHGGTCLNTPGS
FRCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDDC
PGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSC
VCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPC
HEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCG
RGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCVN
GGVCKDRVNGFSCTCPSGFSGSTCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGT
LCERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLDL
VDKYLCRCPSGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEINE
CASSPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSHPCAHEPCSHGICYDAPGGFRCVC
EPGWSGPRCSQSLARDACESQPCRAGGTCSSDGMGFHCTCPPGVQGRQCELLSPCTPNPC
EHGGRCESAPGQLPVCSCPQSWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSCTCHGG
YTGPSCDQDINDCDPNPCLNGGSCQDGVGSFSCSCLAGFAGPRCARDVDECLSNPCGPGT
CTDHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGAHCQ
HEADPCLSRPCLHGGVCSAAHPGFRCTCPESFTGPQCQTLVDWCSRQPCQNGGRCVQTGA
YCLCPPGWSGRLCDIRSLPCREAAAQIGVRLEQLCQAGGQCVDEDSSHYCVCLEGRTGSH
CEQEVDPCLAQPCQHGGTCRGYMGGYMCECLPGYIGDNCEDDVDECASQPCQHGGSCIDL
VARYLCSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLHNGTCVDLVGGFRCTCPPGYTGL
RCEADINECRSGACHAAHTRDCLQDPGGGFRCLCHAGFSGPRCQTVLSPCESQPCQHGGQ
CRPSPGPGGGLTFTCHCAQPFWGPRCERVARSCRELQCPVGVPCQQTPRGPRCTCPPGLS
GPSCRSFPGSPPGASNASCAAAPCLHGGSCRPAPLAPFYRCACAQGWTGPRCEAPAAAPE
VSEEPRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNS
RCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDC
ASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHR
PSPGSESRARRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERL
DFPYPLRDVRGEPLEPPEPSVPLLPLLLAGAVLLLVILVLGVMVARRKREHSTLWFPEGF
SLHKDVASGHKGRREPVGQDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGMG
AEEAVDCRQWTQHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASFCG
GALEPMPTEEDEADDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLLD
AGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVEG
MVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDTKEETPLFLAA
REGSYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPHGLG
PLLCPPGAFLPGLKAAQSGSKKSRRPPGKAGLGPQGPRGRGKKLTLACPGPLADSSVTLS
PVDSLDSPRPFGGPPASPGGFPLEGPYAAATATAVSLAQLGGPGRAGLGRQPPGGCVLSL
GLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGTPVSPQERPPPYLAVPGHGEE
YPAAGAHSSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSESTPSPATATGAM
ATTTGALPAQPFPLSVPSSLAQAQTQLGPQPEVTPKRQVLA
Download sequence
Identical sequences H2NXW0
9600.ENSPPYP00000010835 ENSPPYP00000010835 ENSPPYP00000010835 XP_002828866.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]