SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010859 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010859
Domain Number 1 Region: 1-139,232-269
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.6e-56
Family Calnexin/calreticulin 0.00018
Further Details:      
 
Domain Number 2 Region: 142-225
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 5.89e-21
Family P-domain of calnexin/calreticulin 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010859   Gene: ENSPPYG00000009689   Transcript: ENSPPYT00000011283
Sequence length 319
Comment pep:known_by_projection chromosome:PPYG2:19:16888606:16900253:-1 gene:ENSPPYG00000009689 transcript:ENSPPYT00000011283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGK
SQYYIMFGPDICGFDIKKVHVILHFKNQYHENKKPIRCKVDGFTHLYTLILRPDLSYDVK
IDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASASKQSDWNG
ELDGDWPAPMLQKPPYQDGLKPEGIHKDIWLHHKMKNTNYLTQYDLSEFENIGAIGLELW
QVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLS
GKINGHEHYFNQFHRRNEL
Download sequence
Identical sequences H2NXY3
9600.ENSPPYP00000010859 ENSPPYP00000010859 ENSPPYP00000010859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]