SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010875 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010875
Domain Number 1 Region: 95-180
Classification Level Classification E-value
Superfamily vWA-like 0.0000604
Family Ku80 subunit N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010875   Gene: ENSPPYG00000009705   Transcript: ENSPPYT00000011299
Sequence length 328
Comment pep:known chromosome:PPYG2:19:17643362:17654949:1 gene:ENSPPYG00000009705 transcript:ENSPPYT00000011299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVPEPSSPTEEEEEEEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADD
GSPNTSGAGPKSWQVPPPAPEVQIRTPRVNCPEKVIICLDLSEEMSLPKLESFNGSKTNA
LNVSQKMIEMFVRTKHKIDKSHEFALVVVNDDTAWLSGLTSDPRELCSCLYDLETASCST
FNISGASPARQQKTELPVTENVQTIPPPYVVRTILVYSRPPCQPQFSLTEPMKKMFQCPY
FFFDVVYIHNGTEEKEEMSWKDMFAFMGSLDTKGTSYKYEVALAGPALELHNCMAKLLAH
PLQRPCQSHASYSLLEEEDEATEVEATV
Download sequence
Identical sequences H2NXZ9
ENSPPYP00000010875 ENSPPYP00000010875 9600.ENSPPYP00000010875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]