SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010948 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010948
Domain Number 1 Region: 336-428
Classification Level Classification E-value
Superfamily Immunoglobulin 3.41e-18
Family I set domains 0.027
Further Details:      
 
Domain Number 2 Region: 188-241
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000157
Family TSP-1 type 1 repeat 0.00087
Further Details:      
 
Domain Number 3 Region: 255-317
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000981
Family Carboxypeptidase regulatory domain 0.077
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000010948
Domain Number - Region: 518-571
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000745
Family Carboxypeptidase regulatory domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010948   Gene: ENSPPYG00000009773   Transcript: ENSPPYT00000011374
Sequence length 1201
Comment pep:known_by_projection chromosome:PPYG2:19:19964618:19972850:1 gene:ENSPPYG00000009773 transcript:ENSPPYT00000011374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRGQGGICGGIPPPPSVSAAARPAGVGPEHAAEPGPSLGRSAPAMASLLPLLCLCVVAA
HLAGARDATPTEEPMATALGLERRSVYPGQPSPALEDWEEASEWTSWFNVDHPGGDGDFE
SLAAIRFYYGPARVCPRPLALEARTTDWALPSAVGERVHLNPTRGFWCLNREQPRGRRCS
NYHVRFRCPLEASWGAWGPWGPCSGSCGPGRRLRRRHCPSPAGDACPGRPLEAQKCLRPR
CPGCSLDTCECPDHILLGSVVTPSGQPLPGARVSLRDQPGTVATSDAHGTFRVPGVCADS
RANIRAQMDGFSAGEAQAQANGSISVVTIILDKLEKPYLVKHPESRVREAGQNVTFCCKA
SGTPMPKKYSWFHNGTLLDRRAHGYGAHLELRGLRPDQAGIYHCKAWNEAGAVRSGAARL
TVLAPGQPACDPRPREYLIKLPEDCGQPDSGPAYLDVGLCPDTRCPSLAGSGPRCGDASS
RCCSVRRLERREIHCPGYVLPVKVVAECGCQKCLPPRGLVRGRVVAADSGEPLRFARILL
GQEPIGFTAYQGDFTIEVPPSTQRLVVTFVDPSGEFMDAVRVLPFDPRGAGVYHEVKAMR
KKAPVILDASQSNTIPLGELEDEAPLGELVLPSGAFRRADGKPYSGPVEARVTFVDPRDL
TSAASAPSDLRFVDSDGELAPLRTYGMFSVDLRAPGSAEQLQVGPVAVRVAASQIHMPGH
VEALKLWSLNPETGLWEEESGFRREGSSGPRVRREERVFLVGNVEIRERRLFNLDVPERR
RCFVKVRAYANDKFTPSEQVEGVVVTLVNLEPAPGFSANPRAWGRFDSAVTGPNGACLPA
FCDADRPDAYTALVTATLGGEELEPAPSLPRPLPATVGVTQPYLDRLGYRRTDHDDPAFK
RNGFRINLAKPRPGDPAEANGPVYPWRSLRECQGAPVTASHFRFARVEADKYEYNVVPFR
EGTPASWTGDLLAWWPNPQEFRACFLKVKIQGPQEYMVRSHNAGGSHPRTRGQLYGLRDA
RSVRDPERPGTSAACVEFKCSGMLFDQRQVDRTLVTIMPQGSCRRVAVNGLLRDYLTRHP
PPVPAEDPAAFSMLAPLDPLGHNYGVYTVTDQSPRLAKEIAIGRCFDGSSDGFSREMKAD
AGTAVTFQCREPPAGRPSLFQRLLESPATALGDIRREMSEVAQAQARASGPLRTRRGRVR
Q
Download sequence
Identical sequences H2NY69
ENSPPYP00000010948 ENSPPYP00000010948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]