SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010952 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010952
Domain Number 1 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.98e-22
Family KRAB domain (Kruppel-associated box) 0.00051
Further Details:      
 
Domain Number 2 Region: 318-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.42e-21
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 364-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.82e-18
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 4 Region: 219-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 177-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000363
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 249-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000505
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 82-133
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000232
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 140-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000836
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010952   Gene: ENSPPYG00000009777   Transcript: ENSPPYT00000011378
Sequence length 436
Comment pep:known_by_projection chromosome:PPYG2:19:20093177:20105558:1 gene:ENSPPYG00000009777 transcript:ENSPPYT00000011378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVAFEDVAVNFTQEEWALLSPSQKNLYRDVTLETFRNLASVGIQWKDQDIENLYQNLG
IKLRSLVERLCGRKEGSEHRETFSQIPDCHLNKKSHTGVKPCKCSVCGKVFLRHSFLDRH
MRAHAGHKRSECGGEWREKPRKQKQCGKASTSPSSGARRTVTPTRKRPYECKVCGKAFNS
PNLFQIHQRTHTGKRSYKCREIVRAFTVSSFFRKHGKMHTGEKRYECKYCGKPIDYPSLF
QIHVRTHTGEKPYKCKQCGKAFISAGYLRTHEIRSHALEKSHQCQECGKKLSCSSSLHRH
ERTHSGGKLYECQKCAKVFRCPTSLQAHERAHTGERPYECNKCGKTFNYPSCFRRHKKTH
SGEKPYECKRCGKAFGWCSSLRRHEMTHTGEKPFDCKQCGKVFTFSNYLRLHERTHLAGR
SQCFGRRQGDHLSPGV
Download sequence
Identical sequences H2NY73
XP_002829024.1.23681 ENSPPYP00000010952 9600.ENSPPYP00000010952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]