SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010953 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010953
Domain Number 1 Region: 538-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.9e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.47e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 258-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.06e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 482-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 426-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-22
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 6 Region: 314-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 2-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-19
Family KRAB domain (Kruppel-associated box) 0.00041
Further Details:      
 
Domain Number 8 Region: 584-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.16e-19
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 9 Region: 192-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-18
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 10 Region: 149-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.62e-16
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 11 Region: 87-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000038
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010953   Gene: ENSPPYG00000009778   Transcript: ENSPPYT00000011379
Sequence length 641
Comment pep:known chromosome:PPYG2:19:20140126:20162676:-1 gene:ENSPPYG00000009778 transcript:ENSPPYT00000011379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVSFEDVAVNFTLEEWALLDSSQKKLYEDVMQETFKNLVCLGKKWEDQDIEDDHRNQG
RNRRCHMVERLCESRKGSKCGETTSQMPNVNINKETFTGAKPHECSFCGRDFMHHSSLNR
HMRSHTGQKPNEYQECEKQPRKHKAVEKTFSYHHCFRKHERTHTRVKPYECKQCGKAFIY
YQPFQRHRTHAGEKPYECKQCGKTFIYYQSFQKHAHTGKKPYECKQCGKAFICYQSFQRH
ERTHTGEKPYECKQCGKAFSCPTYFRTHERTHTGEKPYKCKECGKAFSFLSSFRRHKRTH
SGEKPYECKECGKAFFYSASFRAHVITHTGARPYKCKECGKAFNSSNSCRVHERTHIGEK
PYECKQCGKSFSWSISLRLHERTHTGEKPYECKQCHKTFSFSSSLREHETTHTGEKPYEC
KQCGKTFSFSSSLQRHERTHNAEKPYECKQCGKAFRCSSYFRIHERSHTGEKPYECKQCG
KVFIRSSSFRLHERTHTGEKPYECKLCSKTFSFSSSLREHEKIHTGNKPFECKQCGKAFL
RSSQIRLHERTHTGEKPYQCKQCGKAFISSSKFRMHERTHTGEKPYRCKQCGKAFRFSSS
VRIHERSHTGEKPYECKQCGKAFISSSHFRLHERTHMGEKV
Download sequence
Identical sequences H2NY74
ENSPPYP00000010953 ENSPPYP00000010953 9600.ENSPPYP00000010954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]