SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010957 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010957
Domain Number 1 Region: 178-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 459-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.9e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 234-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 402-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.31e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 290-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 346-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 500-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.58e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 8 Region: 136-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 1-28
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000327
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010957   Gene: ENSPPYG00000009782   Transcript: ENSPPYT00000011384
Sequence length 563
Comment pep:known_by_projection chromosome:PPYG2:19:20435906:20453051:1 gene:ENSPPYG00000009782 transcript:ENSPPYT00000011384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLENYRNLVFLGIAVSKPDLITCLEQGKEAWSMKRHEIMVAKPTVMCSHFAQDLWPEQNI
KDSFQKATLKRYGKCRHENLPLRKGCESVDECKMHKGGYNGLYQCLAATQSKIFQCDKYV
KVIHKFSNSNRPKIRHTKKKPFKCRECGKSFRMISCLTEHSRIHTRVNFYKCEECGKAFN
WSSTLTKHKRIHTGEKPYKCEECGKAFNQSSNLIKHKKIHTGEKPYKCEECGKTFNRSST
LTTHKIIHTGEKPYKCKECGKAFNRSSTLTTHRKIHTGEKPYKCEKCGKAFKQSSNLTTH
KIIHTGEKPYKCKKCGKAFNQSAHLTTHEIIHTGEKPYKCEKCGKAFNHFSHLTTHKIIH
TGEKPYKCKECGKAFKHSSTLTKHKIIHTGEKPYKCKECGKAFNQSSKLTEHKKIHTGEK
PYECEKCGKAFNQSSNLTRHKKSHTEEKPYKCEECGKGFKWPSTLTIHKIIHTGEKPYKC
EECGKAFNQSSKLTKHKKIHTGEKPYTCEECGKAFNQSSNLTKHKRIHTGEKPYKCEECD
KAFKWSSVLTKHKIIHTGEKLQM
Download sequence
Identical sequences H2NY78
ENSPPYP00000010957 ENSPPYP00000010957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]