SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010963 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010963
Domain Number 1 Region: 301-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.14e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 439-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.06e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.63e-24
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 4 Region: 386-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.75e-23
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 181-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-21
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 6 Region: 237-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 342-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.94e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 8 Region: 481-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000169
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 9 Region: 143-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000292
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010963   Gene: ENSPPYG00000009787   Transcript: ENSPPYT00000011391
Sequence length 535
Comment pep:known_by_projection chromosome:PPYG2:19:21799339:21817172:1 gene:ENSPPYG00000009787 transcript:ENSPPYT00000011391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGPLTIRDVTVEFSLEEWQCLDTVQQNLYRDVMLENYRNLVFLGIAVSKPDLITCLEQGK
EPWNMKRHEMVAKPPVMCSHIAEDFCPERDIKDFLQNVILRRYDKCEHENLQLRKGCKSV
DECKVCKGGYNGLNQCLITTQSKIYQCDKYVKVFYKFSNSDRHKIRHTEKKTCKCKECGK
SFCMLSQLTRHKRIHIRENSHKCEECGKAFNQSSALTRHKITHTGEKPYKCEECGKAFNR
SSHLTQHKIIHTREKPYKCEECGKAFNRSSHITQHKRIHNREKPFKCDECCKAFKWSSAL
TTLTQHKRIHTGEKPYKCEECGKAFNQSSALTRHKMIHTGEKPYKCEECGKAFNRSSHLT
QHKIIHTREKPYKCEECGKAFNRSSHLTKLTRHKIIHTGEKPYKCEECGKAFNQSSHLTQ
HKIIHTGEKPYKCEECGKAFNRSSHLTQHKVIHTGEKPYKCEECGKPFNRFSYLTVHKRI
HAGEKPYKCEECGKPFNRFSYLTVHKRIHAGENSNKNEECGKACNHSSNLTKHNS
Download sequence
Identical sequences H2NY84
9600.ENSPPYP00000010963 ENSPPYP00000010963 ENSPPYP00000010963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]