SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010964 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010964
Domain Number 1 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 404-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 486-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 5 Region: 345-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 177-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.12e-21
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 7 Region: 531-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-20
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 8 Region: 448-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000101
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 9 Region: 122-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000434
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000010964
Domain Number - Region: 1-27
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000157
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010964   Gene: ENSPPYG00000009788   Transcript: ENSPPYT00000011392
Sequence length 588
Comment pep:known_by_projection chromosome:PPYG2:19:21887450:21910459:-1 gene:ENSPPYG00000009788 transcript:ENSPPYT00000011392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLENYRNLVFLGIAAFKPDLIIFLEQGKEPWNMKRHEMVEEPPVICSHFAQDLWPEQDIE
DSVQKMILRRYERCGHENLHLKIGCTNVDECKVHKEGYNKLNQSLTTTQSNVFQCGKYAN
VFHECSNSNRQKIRHTGKKLLKCEEYVRSFCMLSHLSQHKIIYTGENSYKCEEGYEAFSW
SSPLTYYKSIHTGEKLYKCEECGKAFSNFSILTKHKVIHSGEKPHKCEECGKAFNRSSIL
TEHKIIHTGEKPYKCEECGKAFSKVSTLNTHKAIHAEEKRYKCEECGKAFNSSSKLMEHK
RVHTGEKPYKCEECGKAFSWSSSLTEHKRIHAGEKPYKCEECGKAFNRSTILTKHKIIHT
GEKPYKCEGCGKTFSKVSTLNTHKAIHAEEKPYKCEECGKASNSSSKLMEHKRIHTGEKP
YKCEECGKAFSWSSSLTEHKRIHAGEKPYKCEECGKAFTWSSSFTKHKRIHAVEKPYKCE
ECGKGFSTFSILTKHKVIHTGEKRYKCEECGKAFSWSSILTEHKIIHTGEKPYKCEECGK
AFSRSSSLTRHKRIHTGEKPYKCEECGKAFKSSSTISYHKKIHTGENP
Download sequence
Identical sequences H2NY85
ENSPPYP00000010964 ENSPPYP00000010964 9600.ENSPPYP00000010964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]